| Protein or peptide name: | sORF-4 |
| Chromosome: | XIII |
| Protein or peptide start site: | 480923 |
| Protein or peptide end site: | 481186 |
| ncRNA start site: | NA |
| ncRNA end site: | NA |
| Genome Browser: | NA |
| Protein or peptide sequence: | MISMEAINNFIKTAPKHDYLTGGVHHSGNVDVLQLSGNKEDGSLVWNHTFVDVDNNVVAKFEDALEKLESLHRRSSSSTGNEEHANV |
| Protein or peptide length: | 87aa |
| ncRNA type: | ncRNA |
| ncRNA name: | YKU80-YMR107W intergenic |
| Entrez ID: | NA |
| Experimental species: | Saccharomyces cerevisiae (yeast) |
| Experimental techniques: | Western blotting |
| Experimental sample (cell line and/or tissue): | Saccharomyces cerevisiae (baker’s yeast) |
| Description: | We find unannotated RNAs associate with polyribosomes to extents similar to mRNA and that they encode small open reading frames (ORFs) bound by ribosomes.Our data expand the coding capacity of the yeast genome beyond the current annotation and suggest expression of dozens of short polypeptides from transcripts previously predicted to lack coding potential. |
| Subcellular location: | NA |
| Function: | NA |
| Title of paper: | Translation of Small Open Reading Frameswithin Unannotated RNA Transcriptsin Saccharomyces cerevisiae |
| PMID: | 24931603 |
| Year of publication: | 2014 |
